PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G053100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 594aa    MW: 64194.9 Da    PI: 6.5495
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G053100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.54.7e-083654021954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+ +e+  LA++ gL+  qV++WF N R +
  Brast02G053100.1.p 365 FEHflHPYPKDSEKVMLARQAGLSRGQVSNWFINARVR 402
                         554459******************************88 PP

2BELL95.45.1e-31225295171
                BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                         +rqe+q+k + L+ +l++Vd+rY+qy+ ++q+v++s +a+ag g+a+pYt+lAl++iSrhFr+L+dai  q
  Brast02G053100.1.p 225 DRQEVQNKVTALMGMLDQVDRRYRQYQREMQAVAASLDAAAGPGAARPYTALALQTISRHFRSLRDAIGAQ 295
                         699*****************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.7E-43151294IPR006563POX domain
PfamPF075261.5E-45156292IPR006563POX domain
PROSITE profilePS5007111.839343406IPR001356Homeobox domain
SMARTSM003896.2E-8346410IPR001356Homeobox domain
CDDcd000866.76E-11346407No hitNo description
SuperFamilySSF466893.04E-16347413IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-26349412IPR009057Homeodomain-like
PfamPF059202.6E-16363402IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MATFFSTDQR GLTGGAGGDM SFHHHYPMAS YQDASGGGLI PLPASIAHIA QDEAAAFMGA  60
RADNGQPADS SGAGDLQTQL LMGGDPAAQR RLHQHHQGGG GGLSLSLGTQ VPGVSLYHHQ  120
QQQQYRPGAM ASPMSQPAMA MAMAARQQQH QGSVYVHNSR FLKAARELLD EVVSVRDAIV  180
ERKKKKKTSK EEEECDRDAA SKAKEQDKES HEENSSAAPE LSPADRQEVQ NKVTALMGML  240
DQVDRRYRQY QREMQAVAAS LDAAAGPGAA RPYTALALQT ISRHFRSLRD AIGAQAQAAR  300
RSLGEDAAAS SGGLSRLRYI DQHLRQQRAL QQFGGMMQQQ PQQHAWRPQR GLPESAVSVL  360
RAWLFEHFLH PYPKDSEKVM LARQAGLSRG QVSNWFINAR VRLWKPMVEE MYKEEFGAEM  420
DSTNSSSDNN NNKQQAGGKA HDDDDQLEDR DEFQSPTSAA AQAQAQMLIA NPYKSEPVGA  480
AMEGTYALLQ GPGGGLLDAL AHHGGGDDGR FMAYGGDMGG VGGGSVSLTL GLQHCNNNKS  540
TSSSNNRNNN NGAEHEQQGL LYGNPGDFDF LSDDRQRFGS SSAASQLLHD FVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-16352409158Homeobox protein Meis1
4xrs_B5e-16352409158Homeobox protein Meis1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180186ERKKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229148.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_003562035.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_010229144.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_014752493.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLI1H9D30.0I1H9D3_BRADI; Uncharacterized protein
STRINGBRADI1G74060.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-79BEL1-like homeodomain 7